![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
![]() | Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) ![]() duplication: contains two structural repeats of 3-helical motif |
![]() | Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins) automatically mapped to Pfam PF01126 |
![]() | Protein Heme oxygenase-1 (HO-1) [48615] (3 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [48617] (25 PDB entries) Uniprot P06762 11-222 |
![]() | Domain d1dvgb_: 1dvg B: [19511] complexed with hem |
PDB Entry: 1dvg (more details), 2.2 Å
SCOPe Domain Sequences for d1dvgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dvgb_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Norway rat (Rattus norvegicus) [TaxId: 10116]} sqdlsealkeatkevhiraensefmrnfqkgqvsregfklvtaslyhiytaleeeiernk qnpvyaplyfpeelhrraaleqdlafwygphwqeaipytpatqhyvkrlhevggthpell vahaytrylgdlsggqvlkkiaqkalalpssgeglasftfpsidnptkfkqlyrarmntl eltpevkhrvteeaktafllnielfeelqallte
Timeline for d1dvgb_: