Lineage for d1dvgb_ (1dvg B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732616Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2732617Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2732618Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
    automatically mapped to Pfam PF01126
  6. 2732664Protein Heme oxygenase-1 (HO-1) [48615] (3 species)
  7. 2732724Species Norway rat (Rattus norvegicus) [TaxId:10116] [48617] (25 PDB entries)
    Uniprot P06762 11-222
  8. 2732741Domain d1dvgb_: 1dvg B: [19511]
    complexed with hem

Details for d1dvgb_

PDB Entry: 1dvg (more details), 2.2 Å

PDB Description: crystal structure of rat heme oxygenase-1 in complex with heme; seleleno-methionine derivative, mutated at m51t,m93l,m155l,m191l.
PDB Compounds: (B:) heme oxygenase-1

SCOPe Domain Sequences for d1dvgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dvgb_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sqdlsealkeatkevhiraensefmrnfqkgqvsregfklvtaslyhiytaleeeiernk
qnpvyaplyfpeelhrraaleqdlafwygphwqeaipytpatqhyvkrlhevggthpell
vahaytrylgdlsggqvlkkiaqkalalpssgeglasftfpsidnptkfkqlyrarmntl
eltpevkhrvteeaktafllnielfeelqallte

SCOPe Domain Coordinates for d1dvgb_:

Click to download the PDB-style file with coordinates for d1dvgb_.
(The format of our PDB-style files is described here.)

Timeline for d1dvgb_: