SCOPe 2.02: Domain d4etsa_: 4ets A:

Lineage for d4etsa_ (4ets A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (19 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:32022] [195104] (1 PDB entry)

8. Domain d4etsa_: 4ets A: [195106]
   automated match to d2xigc_
   complexed with cl, zn

Details for d4etsa_

PDB Entry: 4ets, 2.1 Å

PDB Description: Crystal structure of Campylobacter jejuni ferric uptake regulator

PDB Compounds: (A:) ferric uptake regulation protein

SCOPe Domain Sequences for d4etsa_:

Sequence, based on SEQRES records:

>d4etsa_ a.4.5.0 (A:) automated matches {Campylobacter jejuni [TaxId: 32022]}
enveydvllerfkkilrqgglkytkqrevllktlyhsdthytpeslymeikqaepdlnvg
iatvyrtlnlleeaemvtsisfgsagkkyelankphhdhmickncgkiiefenpiierqq
aliakehgfkltghlmqlygvcgdcn

Sequence, based on observed residues (ATOM records):

>d4etsa_ a.4.5.0 (A:) automated matches {Campylobacter jejuni [TaxId: 32022]}
enveydvllerfkkilrqgglkytkqrevllktlyhsdthytpeslymeikqaepdlnvg
iatvyrtlnlleeaemvtsiskkyelankphhdhmickncgkiiefenpiierqqaliak
ehgfkltghlmqlygvcgdcn

Timeline for d4etsa_:

• d4etsa_ is new in SCOPe 2.02-stable
  
• d4etsa_ appears in SCOPe 2.03
  
• d4etsa_ appears in the current release, SCOPe 2.08