Lineage for d4etsa_ (4ets A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694639Species Campylobacter jejuni [TaxId:32022] [195104] (2 PDB entries)
  8. 2694641Domain d4etsa_: 4ets A: [195106]
    Other proteins in same PDB: d4etsb2
    automated match to d2xigc_
    complexed with cl, zn

Details for d4etsa_

PDB Entry: 4ets (more details), 2.1 Å

PDB Description: Crystal structure of Campylobacter jejuni ferric uptake regulator
PDB Compounds: (A:) ferric uptake regulation protein

SCOPe Domain Sequences for d4etsa_:

Sequence, based on SEQRES records: (download)

>d4etsa_ a.4.5.0 (A:) automated matches {Campylobacter jejuni [TaxId: 32022]}
enveydvllerfkkilrqgglkytkqrevllktlyhsdthytpeslymeikqaepdlnvg
iatvyrtlnlleeaemvtsisfgsagkkyelankphhdhmickncgkiiefenpiierqq
aliakehgfkltghlmqlygvcgdcn

Sequence, based on observed residues (ATOM records): (download)

>d4etsa_ a.4.5.0 (A:) automated matches {Campylobacter jejuni [TaxId: 32022]}
enveydvllerfkkilrqgglkytkqrevllktlyhsdthytpeslymeikqaepdlnvg
iatvyrtlnlleeaemvtsiskkyelankphhdhmickncgkiiefenpiierqqaliak
ehgfkltghlmqlygvcgdcn

SCOPe Domain Coordinates for d4etsa_:

Click to download the PDB-style file with coordinates for d4etsa_.
(The format of our PDB-style files is described here.)

Timeline for d4etsa_: