SCOPe 2.06: Domain d4etsb1: 4ets B:102-254

Lineage for d4etsb1 (4ets B:102-254)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (68 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:32022] [195104] (1 PDB entry)

8. Domain d4etsb1: 4ets B:102-254 [195105]
   Other proteins in same PDB: d4etsb2
   automated match to d2xigc_
   complexed with cl, zn

Details for d4etsb1

PDB Entry: 4ets, 2.1 Å

PDB Description: Crystal structure of Campylobacter jejuni ferric uptake regulator

PDB Compounds: (B:) ferric uptake regulation protein

SCOPe Domain Sequences for d4etsb1:

Sequence, based on SEQRES records:

>d4etsb1 a.4.5.0 (B:102-254) automated matches {Campylobacter jejuni [TaxId: 32022]}
lienveydvllerfkkilrqgglkytkqrevllktlyhsdthytpeslymeikqaepdln
vgiatvyrtlnlleeaemvtsisfgsagkkyelankphhdhmickncgkiiefenpiier
qqaliakehgfkltghlmqlygvcgdcnnqkak

Sequence, based on observed residues (ATOM records):

>d4etsb1 a.4.5.0 (B:102-254) automated matches {Campylobacter jejuni [TaxId: 32022]}
lienveydvllerfkytkqrevllktlyhsdthytpeslymeikqaepdlnvgiatvyrt
lnlleeaemvtsisfgsagkkyelankphhdhmickncgkiiefenpiierqqaliakeh
gfkltghlmqlygvcgdcnnqkak

Timeline for d4etsb1:

• d4etsb1 first appeared in SCOPe 2.02, called d4etsb_
  
• d4etsb1 was called d4etsb_ in SCOPe 2.05
  
• d4etsb1 appears in SCOPe 2.07
  
• d4etsb1 appears in the current release, SCOPe 2.08