Lineage for d4etsb_ (4ets B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1722860Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1722861Protein automated matches [190154] (57 species)
    not a true protein
  7. 1722901Species Campylobacter jejuni [TaxId:32022] [195104] (1 PDB entry)
  8. 1722903Domain d4etsb_: 4ets B: [195105]
    automated match to d2xigc_
    complexed with cl, zn

Details for d4etsb_

PDB Entry: 4ets (more details), 2.1 Å

PDB Description: Crystal structure of Campylobacter jejuni ferric uptake regulator
PDB Compounds: (B:) ferric uptake regulation protein

SCOPe Domain Sequences for d4etsb_:

Sequence, based on SEQRES records: (download)

>d4etsb_ a.4.5.0 (B:) automated matches {Campylobacter jejuni [TaxId: 32022]}
atyammlienveydvllerfkkilrqgglkytkqrevllktlyhsdthytpeslymeikq
aepdlnvgiatvyrtlnlleeaemvtsisfgsagkkyelankphhdhmickncgkiiefe
npiierqqaliakehgfkltghlmqlygvcgdcnnqkak

Sequence, based on observed residues (ATOM records): (download)

>d4etsb_ a.4.5.0 (B:) automated matches {Campylobacter jejuni [TaxId: 32022]}
atyamlienveydvllerfkytkqrevllktlyhsdthytpeslymeikqaepdlnvgia
tvyrtlnlleeaemvtsisfgsagkkyelankphhdhmickncgkiiefenpiierqqal
iakehgfkltghlmqlygvcgdcnnqkak

SCOPe Domain Coordinates for d4etsb_:

Click to download the PDB-style file with coordinates for d4etsb_.
(The format of our PDB-style files is described here.)

Timeline for d4etsb_: