SCOP 1.67: Domain d1dvga_: 1dvg A:

Lineage for d1dvga_ (1dvg A:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (4 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (2 proteins)

6. Protein Heme oxygenase-1 (HO-1) [48615] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [48617] (9 PDB entries)

8. Domain d1dvga_: 1dvg A: [19510]

Details for d1dvga_

PDB Entry: 1dvg, 2.2 Å

PDB Description: crystal structure of rat heme oxygenase-1 in complex with heme; seleleno-methionine derivative, mutated at m51t,m93l,m155l,m191l.

SCOP Domain Sequences for d1dvga_:

Sequence; same for both SEQRES and ATOM records:

>d1dvga_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Rat (Rattus norvegicus)}
sqdlsealkeatkevhiraensefmrnfqkgqvsregfklvtaslyhiytaleeeiernk
qnpvyaplyfpeelhrraaleqdlafwygphwqeaipytpatqhyvkrlhevggthpell
vahaytrylgdlsggqvlkkiaqkalalpssgeglasftfpsidnptkfkqlyrarmntl
eltpevkhrvteeaktafllnielfeelqallte

Timeline for d1dvga_:

• d1dvga_ first appeared (with stable ids) in SCOP 1.55
  
• d1dvga_ appears in SCOP 1.65
  
• d1dvga_ appears in SCOP 1.69
  
• d1dvga_ appears in the current release, SCOPe 2.08