Lineage for d1dvga_ (1dvg A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6684Fold a.132: Heme oxygenase-1 (HO-1) [48612] (1 superfamily)
  4. 6685Superfamily a.132.1: Heme oxygenase-1 (HO-1) [48613] (1 family) (S)
  5. 6686Family a.132.1.1: Heme oxygenase-1 (HO-1) [48614] (1 protein)
  6. 6687Protein Heme oxygenase-1 (HO-1) [48615] (2 species)
  7. 6691Species Rat (Rattus norvegicus) [TaxId:10116] [48617] (2 PDB entries)
  8. 6692Domain d1dvga_: 1dvg A: [19510]

Details for d1dvga_

PDB Entry: 1dvg (more details), 2.2 Å

PDB Description: crystal structure of rat heme oxygenase-1 in complex with heme; seleleno-methionine derivative, mutated at m51t,m93l,m155l,m191l.

SCOP Domain Sequences for d1dvga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dvga_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Rat (Rattus norvegicus)}
sqdlsealkeatkevhiraensefmrnfqkgqvsregfklvtaslyhiytaleeeiernk
qnpvyaplyfpeelhrraaleqdlafwygphwqeaipytpatqhyvkrlhevggthpell
vahaytrylgdlsggqvlkkiaqkalalpssgeglasftfpsidnptkfkqlyrarmntl
eltpevkhrvteeaktafllnielfeelqallte

SCOP Domain Coordinates for d1dvga_:

Click to download the PDB-style file with coordinates for d1dvga_.
(The format of our PDB-style files is described here.)

Timeline for d1dvga_: