Lineage for d4ffya_ (4ffy A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1111574Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1111941Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 1111986Protein automated matches [190183] (5 species)
    not a true protein
  7. 1111987Species Dengue virus 1 [TaxId:11053] [195098] (3 PDB entries)
  8. 1111989Domain d4ffya_: 4ffy A: [195099]
    automated match to d2jsfa1
    complexed with cl, gol, so4

Details for d4ffya_

PDB Entry: 4ffy (more details), 2.5 Å

PDB Description: Crystal structure of DENV1-E111 single chain variable fragment bound to DENV-1 DIII, strain 16007.
PDB Compounds: (A:) Envelope glycoprotein

SCOPe Domain Sequences for d4ffya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ffya_ b.1.18.4 (A:) automated matches {Dengue virus 1 [TaxId: 11053]}
yvmctgsfklekevaetqhgtvlvqvkyegtdapckipfstqdekgatqngrlitanpiv
tdkekpvnieaeppfgesyivvgagekalklswfkkg

SCOPe Domain Coordinates for d4ffya_:

Click to download the PDB-style file with coordinates for d4ffya_.
(The format of our PDB-style files is described here.)

Timeline for d4ffya_: