Lineage for d4ffya_ (4ffy A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765451Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 2765495Protein automated matches [190183] (10 species)
    not a true protein
  7. 2765496Species Dengue virus 1 [TaxId:11053] [195098] (4 PDB entries)
  8. 2765498Domain d4ffya_: 4ffy A: [195099]
    Other proteins in same PDB: d4ffyh_, d4ffyl_
    automated match to d2jsfa1
    complexed with cl, gol, so4

Details for d4ffya_

PDB Entry: 4ffy (more details), 2.5 Å

PDB Description: Crystal structure of DENV1-E111 single chain variable fragment bound to DENV-1 DIII, strain 16007.
PDB Compounds: (A:) Envelope glycoprotein

SCOPe Domain Sequences for d4ffya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ffya_ b.1.18.4 (A:) automated matches {Dengue virus 1 [TaxId: 11053]}
yvmctgsfklekevaetqhgtvlvqvkyegtdapckipfstqdekgatqngrlitanpiv
tdkekpvnieaeppfgesyivvgagekalklswfkkg

SCOPe Domain Coordinates for d4ffya_:

Click to download the PDB-style file with coordinates for d4ffya_.
(The format of our PDB-style files is described here.)

Timeline for d4ffya_: