Lineage for d3c0ca_ (3c0c A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1120542Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1120633Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1120995Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 1120996Protein automated matches [190457] (5 species)
    not a true protein
  7. 1121041Species Norway rat (Rattus norvegicus) [TaxId:10116] [189104] (2 PDB entries)
  8. 1121044Domain d3c0ca_: 3c0c A: [195097]
    automated match to d3iqlb_

Details for d3c0ca_

PDB Entry: 3c0c (more details), 1.7 Å

PDB Description: X-ray Crystal Structure of the Rat Endophilin A2 SH3 Domain
PDB Compounds: (A:) Endophilin-A2

SCOPe Domain Sequences for d3c0ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c0ca_ b.34.2.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pldqpsckalydfependgelgfregdlitltnqidenwyegmlhgqsgffplsyvqvlv
plpq

SCOPe Domain Coordinates for d3c0ca_:

Click to download the PDB-style file with coordinates for d3c0ca_.
(The format of our PDB-style files is described here.)

Timeline for d3c0ca_: