Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
Protein automated matches [190142] (21 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [189596] (2 PDB entries) |
Domain d3sczb_: 3scz B: [195090] automated match to d1i80a_ complexed with hpa |
PDB Entry: 3scz (more details), 1.95 Å
SCOPe Domain Sequences for d3sczb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sczb_ c.56.2.1 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} dpdelarraaqviadrtgigehdvavvlgsgwlpavaalgspttvlpqaelpgfvpptaa ghagellsvpigahrvlvlagrihayeghdlryvvhpvraaraagaqimvltnaagglra dlqvgqpvlisdhlnltarsplvggefvdltdaysprlrelarqsdpqlaegvyaglpgp hyetpaeirmlqtlgadlvgmstvhetiaaraagaevlgvslvtnlaagitgeplshaev laagaasatrmgalladviarf
Timeline for d3sczb_: