Lineage for d3sczb_ (3scz B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2887828Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2888641Protein automated matches [190142] (21 species)
    not a true protein
  7. 2888735Species Mycobacterium tuberculosis [TaxId:1773] [189596] (2 PDB entries)
  8. 2888737Domain d3sczb_: 3scz B: [195090]
    automated match to d1i80a_
    complexed with hpa

Details for d3sczb_

PDB Entry: 3scz (more details), 1.95 Å

PDB Description: Combining crystallographic, thermodynamic, and molecular dynamics studies of Mycobacterium tuberculosis purine nucleoside phosphorylase
PDB Compounds: (B:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d3sczb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sczb_ c.56.2.1 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dpdelarraaqviadrtgigehdvavvlgsgwlpavaalgspttvlpqaelpgfvpptaa
ghagellsvpigahrvlvlagrihayeghdlryvvhpvraaraagaqimvltnaagglra
dlqvgqpvlisdhlnltarsplvggefvdltdaysprlrelarqsdpqlaegvyaglpgp
hyetpaeirmlqtlgadlvgmstvhetiaaraagaevlgvslvtnlaagitgeplshaev
laagaasatrmgalladviarf

SCOPe Domain Coordinates for d3sczb_:

Click to download the PDB-style file with coordinates for d3sczb_.
(The format of our PDB-style files is described here.)

Timeline for d3sczb_: