SCOPe 2.05: Domain d3seab_: 3sea B:

Lineage for d3seab_ (3sea B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein GTP-binding protein RheB [142275] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142276] (3 PDB entries)
   Uniprot Q15382 3-169

8. Domain d3seab_: 3sea B: [195089]
   automated match to d1xtqa1
   complexed with act, gdp, gnp, mg; mutant

Details for d3seab_

PDB Entry: 3sea, 2 Å

PDB Description: Structure of Rheb-Y35A mutant in GDP- and GMPPNP-bound forms

PDB Compounds: (B:) GTP-binding protein Rheb

SCOPe Domain Sequences for d3seab_:

Sequence; same for both SEQRES and ATOM records:

>d3seab_ c.37.1.8 (B:) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]}
qsksrkiailgyrsvgkssltiqfvegqfvdsadptientftklitvngqeyhlqlvdta
gqdeysifpqtysidingyilvysvtsiksfevikvihgklldmvgkvqipimlvgnkkd
lhmervisyeegkalaeswnaaflessakenqtavdvfrriileaek

Timeline for d3seab_:

• d3seab_ first appeared in SCOPe 2.02
  
• d3seab_ appears in SCOPe 2.04
  
• d3seab_ appears in SCOPe 2.06
  
• d3seab_ appears in the current release, SCOPe 2.08