Lineage for d3v3hb_ (3v3h B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2067964Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2067965Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2067966Family b.74.1.1: Carbonic anhydrase [51070] (2 protein domains)
    automatically mapped to Pfam PF00194
  6. 2067967Protein Carbonic anhydrase [51071] (10 species)
  7. 2068005Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (675 PDB entries)
    Uniprot P00918
  8. 2068283Domain d3v3hb_: 3v3h B: [195077]
    automated match to d2foua_
    complexed with cl, zn; mutant

Details for d3v3hb_

PDB Entry: 3v3h (more details), 1.85 Å

PDB Description: kinetic and structural studies of thermostabilized mutants of hca ii.
PDB Compounds: (B:) Carbonic anhydrase 2

SCOPe Domain Sequences for d3v3hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v3hb_ b.74.1.1 (B:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hhwgfgkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnl
ghafnvefddsqdkavlkggpldgtyrliqfhfhwgshdgqgsehtvdkkkyaaelhlvh
wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslttppllecvtwivlkepisvsseqvskfrklnfngegepeepmvd
nwrpaqplknrqikasfk

SCOPe Domain Coordinates for d3v3hb_:

Click to download the PDB-style file with coordinates for d3v3hb_.
(The format of our PDB-style files is described here.)

Timeline for d3v3hb_: