Lineage for d3zs7a_ (3zs7 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137472Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2137707Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2137708Protein automated matches [190117] (40 species)
    not a true protein
  7. 2137948Species Trypanosoma brucei [TaxId:185431] [195074] (1 PDB entry)
  8. 2137949Domain d3zs7a_: 3zs7 A: [195075]
    automated match to d3keub_
    complexed with atp, po4

Details for d3zs7a_

PDB Entry: 3zs7 (more details), 2 Å

PDB Description: crystal structure of pyridoxal kinase from trypanosoma brucei
PDB Compounds: (A:) Pyridoxal kinase

SCOPe Domain Sequences for d3zs7a_:

Sequence, based on SEQRES records: (download)

>d3zs7a_ c.72.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 185431]}
msektvlsiqsfvthgyvgnkaatfplqlhgfdvdgintvclsnhsgypvirghrmslqe
ydelmegvrannflsnyryiltgyinnvdiigrirdtlkevrelrekedkkltficdpvm
gddgimyckkevldayrelvpladivtpnyfeasllsgvtvndlssailaadwfhncgva
hviiksfreqenpthlrflysvkegseaavrrfsgvvpyhegrytgtgdvfaacllafsh
shpmdvaigksmavlqeliiatrkeggdgksslksrelrvvaspqvvlqpstvvdvkpi

Sequence, based on observed residues (ATOM records): (download)

>d3zs7a_ c.72.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 185431]}
msektvlsiqsfvthgyvgnkaatfplqlhgfdvdgintvclsnhsgypvirghrmslqe
ydelmegvrannflsnyryiltgyinnvdiigrirdtlkevrelrekedkkltficdpvm
kevldayrelvpladivtpnyfeasllsgvtvndlssailaadwfhncgvahviiksfrn
pthlrflysvkegseaavrrfsgvvpyhegrytgtgdvfaacllafshshpmdvaigksm
avlqeliiatrksrelrvvaspqvvlqpstvvdvkpi

SCOPe Domain Coordinates for d3zs7a_:

Click to download the PDB-style file with coordinates for d3zs7a_.
(The format of our PDB-style files is described here.)

Timeline for d3zs7a_: