![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
![]() | Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) ![]() PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
![]() | Family f.1.4.0: automated matches [195065] (1 protein) not a true family |
![]() | Protein automated matches [195066] (3 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [195067] (4 PDB entries) |
![]() | Domain d2voia_: 2voi A: [195068] automated match to d2yj1a_ complexed with cl |
PDB Entry: 2voi (more details), 2.1 Å
SCOPe Domain Sequences for d2voia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2voia_ f.1.4.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} smaeselmhihslaehylqyvlqvpafesapsqacrvlqrvafsvqkeveknlksylddf hvesidtariifnqvmekefedgiinwgrivtifafggvllkklkqeqialdvsaykqvs sfvaefimnntgewirqnggwedgfikkfe
Timeline for d2voia_: