Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (21 species) not a true protein |
Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [195048] (5 PDB entries) |
Domain d4f1ta_: 4f1t A: [195051] automated match to d3dtca_ complexed with h52 |
PDB Entry: 4f1t (more details), 2.3 Å
SCOPe Domain Sequences for d4f1ta_:
Sequence, based on SEQRES records: (download)
>d4f1ta_ d.144.1.0 (A:) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} rlptladneieyekqigkggfglvhkgrlvkdksvvaikslilgdsegetemiekfqefq revfimsnlnhpnivklyglmhnpprmvmefvpcgdlyhrlldkahpikwsvklrlmldi algieymqnqnppivhrdlrspniflqsldenapvcakvadfglsqqsvhsvsgllgnfq wmapetigaeeesytekadtysfamilytiltgegpfdeysygkikfinmireeglrpti pedcpprlrnvielcwsgdpkkrphfsyivkelsel
>d4f1ta_ d.144.1.0 (A:) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} rlptladneieyekqigkggfglvhkgrlvkdksvvaikslitemiekfqefqrevfims nlnhpnivklyglmhnpprmvmefvpcgdlyhrlldkahpikwsvklrlmldialgieym qnqnppivhrdlrspniflqsldenapvcakvadfglsqqsvhsvsgllgnfqwmapeti gaeeesytekadtysfamilytiltgegpfdeysygkikfinmireeglrptipedcppr lrnvielcwsgdpkkrphfsyivkelsel
Timeline for d4f1ta_: