Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (25 species) not a true protein |
Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [195048] (6 PDB entries) |
Domain d4f0fa1: 4f0f A:1019-1292 [195049] Other proteins in same PDB: d4f0fa2 automated match to d3dtca_ complexed with acp |
PDB Entry: 4f0f (more details), 1.8 Å
SCOPe Domain Sequences for d4f0fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f0fa1 d.144.1.0 (A:1019-1292) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} ptladneieyekqigkggfglvhkgrlvkdksvvaikslilgdsegetemiekfqefqre vfimsnlnhpnivklyglmhnpprmvmefvpcgdlyhrlldkahpikwsvklrlmldial gieymqnqnppivhrdlrspniflqsldenapvcakvadfglsqqsvhsvsgllgnfqwm apetigaeeesytekadtysfamilytiltgegpfdeysygkikfinmireeglrptipe dcpprlrnvielcwsgdpkkrphfsyivkelsel
Timeline for d4f0fa1: