Lineage for d4f0fa1 (4f0f A:1019-1292)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2222093Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2222094Protein automated matches [190417] (25 species)
    not a true protein
  7. 2223656Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [195048] (6 PDB entries)
  8. 2223657Domain d4f0fa1: 4f0f A:1019-1292 [195049]
    Other proteins in same PDB: d4f0fa2
    automated match to d3dtca_
    complexed with acp

Details for d4f0fa1

PDB Entry: 4f0f (more details), 1.8 Å

PDB Description: Crystal Structure of the Roco4 Kinase Domain bound to AppCp from D. discoideum
PDB Compounds: (A:) Serine/threonine-protein kinase roco4

SCOPe Domain Sequences for d4f0fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f0fa1 d.144.1.0 (A:1019-1292) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
ptladneieyekqigkggfglvhkgrlvkdksvvaikslilgdsegetemiekfqefqre
vfimsnlnhpnivklyglmhnpprmvmefvpcgdlyhrlldkahpikwsvklrlmldial
gieymqnqnppivhrdlrspniflqsldenapvcakvadfglsqqsvhsvsgllgnfqwm
apetigaeeesytekadtysfamilytiltgegpfdeysygkikfinmireeglrptipe
dcpprlrnvielcwsgdpkkrphfsyivkelsel

SCOPe Domain Coordinates for d4f0fa1:

Click to download the PDB-style file with coordinates for d4f0fa1.
(The format of our PDB-style files is described here.)

Timeline for d4f0fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4f0fa2