SCOPe 2.08: Domain d4f0fa1: 4f0f A:1019-1292

Lineage for d4f0fa1 (4f0f A:1019-1292)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (37 species)
   not a true protein

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [195048] (6 PDB entries)

8. Domain d4f0fa1: 4f0f A:1019-1292 [195049]
   Other proteins in same PDB: d4f0fa2
   automated match to d3dtca_
   complexed with acp

Details for d4f0fa1

PDB Entry: 4f0f, 1.8 Å

PDB Description: Crystal Structure of the Roco4 Kinase Domain bound to AppCp from D. discoideum

PDB Compounds: (A:) Serine/threonine-protein kinase roco4

SCOPe Domain Sequences for d4f0fa1:

Sequence; same for both SEQRES and ATOM records:

>d4f0fa1 d.144.1.0 (A:1019-1292) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
ptladneieyekqigkggfglvhkgrlvkdksvvaikslilgdsegetemiekfqefqre
vfimsnlnhpnivklyglmhnpprmvmefvpcgdlyhrlldkahpikwsvklrlmldial
gieymqnqnppivhrdlrspniflqsldenapvcakvadfglsqqsvhsvsgllgnfqwm
apetigaeeesytekadtysfamilytiltgegpfdeysygkikfinmireeglrptipe
dcpprlrnvielcwsgdpkkrphfsyivkelsel

Timeline for d4f0fa1:

• d4f0fa1 first appeared in SCOPe 2.02, called d4f0fa_
  
• d4f0fa1 appears in SCOPe 2.07