SCOPe 2.06: Domain d4f82a1: 4f82 A:1-168

Lineage for d4f82a1 (4f82 A:1-168)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Burkholderia cenocepacia [TaxId:216591] [195045] (2 PDB entries)

8. Domain d4f82a1: 4f82 A:1-168 [195047]
   Other proteins in same PDB: d4f82a2, d4f82b2
   automated match to d1tp9a1

Details for d4f82a1

PDB Entry: 4f82, 1.85 Å

PDB Description: X-ray crystal structure of a putative thioredoxin reductase from Burkholderia cenocepacia

PDB Compounds: (A:) thioredoxin reductase

SCOPe Domain Sequences for d4f82a1:

Sequence; same for both SEQRES and ATOM records:

>d4f82a1 c.47.1.0 (A:1-168) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
miqvgdalpdaqlfefiddaregctlgpnacsvrdqvagkrvvifglpgaftptcsaqhv
pgyvehaeqlraagideiwcvsvndafvmgawgrdlhtagkvrmmadgsaafthalgltq
dlsargmgirslryamvidggvvktlaveapgkfevsdaasvlatlts

Timeline for d4f82a1:

• d4f82a1 first appeared in SCOPe 2.02, called d4f82a_
  
• d4f82a1 was called d4f82a_ in SCOPe 2.05
  
• d4f82a1 appears in SCOPe 2.07
  
• d4f82a1 appears in the current release, SCOPe 2.08