Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (107 species) not a true protein |
Species Burkholderia cenocepacia [TaxId:216591] [195045] (1 PDB entry) |
Domain d4f82b_: 4f82 B: [195046] automated match to d1tp9a1 |
PDB Entry: 4f82 (more details), 1.85 Å
SCOPe Domain Sequences for d4f82b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f82b_ c.47.1.0 (B:) automated matches {Burkholderia cenocepacia [TaxId: 216591]} hmiqvgdalpdaqlfefiddaregctlgpnacsvrdqvagkrvvifglpgaftptcsaqh vpgyvehaeqlraagideiwcvsvndafvmgawgrdlhtagkvrmmadgsaafthalglt qdlsargmgirslryamvidggvvktlaveapgkfevsdaasvlatlts
Timeline for d4f82b_: