SCOPe 2.03: Domain d4f82b_: 4f82 B:

Lineage for d4f82b_ (4f82 B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (107 species)
   not a true protein

7. Species Burkholderia cenocepacia [TaxId:216591] [195045] (1 PDB entry)

8. Domain d4f82b_: 4f82 B: [195046]
   automated match to d1tp9a1

Details for d4f82b_

PDB Entry: 4f82, 1.85 Å

PDB Description: X-ray crystal structure of a putative thioredoxin reductase from Burkholderia cenocepacia

PDB Compounds: (B:) thioredoxin reductase

SCOPe Domain Sequences for d4f82b_:

Sequence; same for both SEQRES and ATOM records:

>d4f82b_ c.47.1.0 (B:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
hmiqvgdalpdaqlfefiddaregctlgpnacsvrdqvagkrvvifglpgaftptcsaqh
vpgyvehaeqlraagideiwcvsvndafvmgawgrdlhtagkvrmmadgsaafthalglt
qdlsargmgirslryamvidggvvktlaveapgkfevsdaasvlatlts

Timeline for d4f82b_:

• d4f82b_ first appeared in SCOPe 2.02
  
• d4f82b_ appears in SCOPe 2.04
  
• d4f82b_ appears in the current release, SCOPe 2.08, called d4f82b1