Lineage for d3shdh_ (3shd H:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1216197Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 1216198Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 1216460Family d.113.1.0: automated matches [191580] (1 protein)
    not a true family
  6. 1216461Protein automated matches [191036] (3 species)
    not a true protein
  7. 1216465Species Escherichia coli [TaxId:405955] [188925] (2 PDB entries)
  8. 1216467Domain d3shdh_: 3shd H: [195041]
    automated match to d3dkud_
    complexed with mn, so4

Details for d3shdh_

PDB Entry: 3shd (more details), 2.5 Å

PDB Description: Crystal structure of Nudix hydrolase Orf153, ymfB, from Escherichia coli K-1
PDB Compounds: (H:) Phosphatase nudJ

SCOPe Domain Sequences for d3shdh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3shdh_ d.113.1.0 (H:) automated matches {Escherichia coli [TaxId: 405955]}
mfkphvtvacvvhaegkflvveetingkalwnqpaghleadetlveaaarelweetgisa
qpqhfirmhqwiapdktpflrflfaieleqicptqphdsdidccrwvsaeeilqasnlrs
plvaesircyqsgqryplemigdfnwpftk

SCOPe Domain Coordinates for d3shdh_:

Click to download the PDB-style file with coordinates for d3shdh_.
(The format of our PDB-style files is described here.)

Timeline for d3shdh_: