Lineage for d1pprn1 (1ppr N:1-156)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777751Fold a.131: Peridinin-chlorophyll protein [48607] (1 superfamily)
    multihelical: forms a boat-shaped protein shell around cofactors
  4. 777752Superfamily a.131.1: Peridinin-chlorophyll protein [48608] (1 family) (S)
    duplication: consists of two 8-helical repeats
  5. 777753Family a.131.1.1: Peridinin-chlorophyll protein [48609] (1 protein)
  6. 777754Protein Peridinin-chlorophyll protein [48610] (1 species)
    soluble light harvesting protein
  7. 777755Species Dinoflagellate (Amphidinium carterae) [TaxId:2961] [48611] (1 PDB entry)
  8. 777758Domain d1pprn1: 1ppr N:1-156 [19504]
    CASP2

Details for d1pprn1

PDB Entry: 1ppr (more details), 2 Å

PDB Description: peridinin-chlorophyll-protein of amphidinium carterae
PDB Compounds: (N:) peridinin-chlorophyll protein

SCOP Domain Sequences for d1pprn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pprn1 a.131.1.1 (N:1-156) Peridinin-chlorophyll protein {Dinoflagellate (Amphidinium carterae) [TaxId: 2961]}
deigdaakklgdasyafakevdwnngiflqapgklqplealkaidkmivmgaaadpkllk
aaaeahhkaigsisgpngvtsradwdnvnaalgrviasvpenmvmdvydsvskitdpkvp
aymkslvngadaekayegflafkdvvkksqvtsaag

SCOP Domain Coordinates for d1pprn1:

Click to download the PDB-style file with coordinates for d1pprn1.
(The format of our PDB-style files is described here.)

Timeline for d1pprn1: