SCOPe 2.02: Domain d3sk0a_: 3sk0 A:

Lineage for d3sk0a_ (3sk0 A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)

6. Protein automated matches [190880] (3 species)
   not a true protein

7. Species Rhodococcus rhodochrous [TaxId:1829] [189127] (6 PDB entries)

8. Domain d3sk0a_: 3sk0 A: [195037]
   automated match to d3fwha_
   complexed with cl; mutant

Details for d3sk0a_

PDB Entry: 3sk0, 1.78 Å

PDB Description: structure of rhodococcus rhodochrous haloalkane dehalogenase dhaa mutant dhaa12

PDB Compounds: (A:) haloalkane dehalogenase

SCOPe Domain Sequences for d3sk0a_:

Sequence; same for both SEQRES and ATOM records:

>d3sk0a_ c.69.1.8 (A:) automated matches {Rhodococcus rhodochrous [TaxId: 1829]}
igtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssylwrniiphvapshrcia
pdligmgksdkpdldyffddhvryldafiealgleevvlvihdwgsalgfhwakrnperv
kgiacmefirpiptwdefhhtevaeeqdhaeaaretfqafrtadvgreliidqnafierv
lpggvvrpltevemdhyrepflkpvdreplwrfpnelpiagepanivalveaymnwlhqs
pvpkllfwgtpgalippaeaarlaeslpncktvdigpglhylqednpdligseiarwlpa
lehhhhhh

Timeline for d3sk0a_:

• d3sk0a_ is new in SCOPe 2.02-stable
  
• d3sk0a_ appears in SCOPe 2.03
  
• d3sk0a_ appears in the current release, SCOPe 2.08, called d3sk0a1