| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily) core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets duplication: consists of two structural repeats |
Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) ![]() binds to the transactivation domain of human p53 |
| Family a.42.1.0: automated matches [191556] (1 protein) not a true family |
| Protein automated matches [190960] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188578] (22 PDB entries) |
| Domain d3u15c_: 3u15 C: [195034] automated match to d3fdoa_ complexed with 03m, so4 |
PDB Entry: 3u15 (more details), 1.8 Å
SCOPe Domain Sequences for d3u15c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u15c_ a.42.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllgell
grqsfsvkdpsplydmlrknlv
Timeline for d3u15c_: