| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
| Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) |
| Protein automated matches [191209] (6 species) not a true protein |
| Species Yellow fever mosquito (Aedes aegypti) [TaxId:7159] [195032] (2 PDB entries) |
| Domain d3uqia_: 3uqi A: [195033] automated match to d3mdyb_ complexed with mpo, so4 |
PDB Entry: 3uqi (more details), 1.3 Å
SCOPe Domain Sequences for d3uqia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uqia_ d.26.1.1 (A:) automated matches {Yellow fever mosquito (Aedes aegypti) [TaxId: 7159]}
mgvqvvtlaagdeatypkagqvavvhytgtladgkvfdssrtrgkpfrftvgrgevirgw
degvaqmsvgqraklvcspdyaygsrghpgvippnatltfdvellrve
Timeline for d3uqia_: