Lineage for d3uqia_ (3uqi A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941337Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2941338Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2941584Protein automated matches [191209] (6 species)
    not a true protein
  7. 2941668Species Yellow fever mosquito (Aedes aegypti) [TaxId:7159] [195032] (2 PDB entries)
  8. 2941669Domain d3uqia_: 3uqi A: [195033]
    automated match to d3mdyb_
    complexed with mpo, so4

Details for d3uqia_

PDB Entry: 3uqi (more details), 1.3 Å

PDB Description: Crystallographic structure of FKBP12 from Aedes aegypti
PDB Compounds: (A:) FKBP-type peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d3uqia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uqia_ d.26.1.1 (A:) automated matches {Yellow fever mosquito (Aedes aegypti) [TaxId: 7159]}
mgvqvvtlaagdeatypkagqvavvhytgtladgkvfdssrtrgkpfrftvgrgevirgw
degvaqmsvgqraklvcspdyaygsrghpgvippnatltfdvellrve

SCOPe Domain Coordinates for d3uqia_:

Click to download the PDB-style file with coordinates for d3uqia_.
(The format of our PDB-style files is described here.)

Timeline for d3uqia_: