Lineage for d3vbgd_ (3vbg D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735235Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 1735236Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 1735237Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
    Pfam PF02201
  6. 1735244Protein MDM2 [47594] (2 species)
  7. 1735262Species Human (Homo sapiens) [TaxId:9606] [47596] (46 PDB entries)
  8. 1735351Domain d3vbgd_: 3vbg D: [195031]
    automated match to d1rv1a_
    complexed with 03m

Details for d3vbgd_

PDB Entry: 3vbg (more details), 2.8 Å

PDB Description: structure of hdm2 with dimer inducing indolyl hydantoin ro-2443
PDB Compounds: (D:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d3vbgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vbgd_ a.42.1.1 (D:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
etlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
lfgvpsfsvkehrkiytmiyrnlvv

SCOPe Domain Coordinates for d3vbgd_:

Click to download the PDB-style file with coordinates for d3vbgd_.
(The format of our PDB-style files is described here.)

Timeline for d3vbgd_: