Lineage for d2pinb_ (2pin B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1747085Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1747086Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1747087Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1747905Protein Thyroid hormone receptor beta (TR-beta) [48530] (1 species)
  7. 1747906Species Human (Homo sapiens) [TaxId:9606] [48531] (15 PDB entries)
    Uniprot P10828 202-460
  8. 1747912Domain d2pinb_: 2pin B: [195024]
    automated match to d3imya_
    complexed with 4hy, leg, so4

Details for d2pinb_

PDB Entry: 2pin (more details), 2.3 Å

PDB Description: thyroid receptor beta in complex with inhibitor
PDB Compounds: (B:) Thyroid hormone receptor Beta-1

SCOPe Domain Sequences for d2pinb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pinb_ a.123.1.1 (B:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]}
kpeptdeeweliktvteahvatnaqgshwkqkrkflpedigqapivnapeggkvdleafs
hftkiitpaitrvvdfakklpmfcelpcedqiillkgccmeimslraavrydpesetltl
ngemavtrgqlkngglgvvsdaifrlgmslssfnlddtevallqavllmssdrpglacve
riekyqdsfllafehyinyrkhhvthfwpkllmkvtdlrmigachasrflhmkvecptel
fpplflevfe

SCOPe Domain Coordinates for d2pinb_:

Click to download the PDB-style file with coordinates for d2pinb_.
(The format of our PDB-style files is described here.)

Timeline for d2pinb_: