SCOPe 2.08: Domain d2pinb_: 2pin B:

Lineage for d2pinb_ (2pin B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein Thyroid hormone receptor beta (TR-beta) [48530] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48531] (22 PDB entries)
   Uniprot P10828 202-460

8. Domain d2pinb_: 2pin B: [195024]
   automated match to d3imya_
   complexed with 4hy, leg, so4

Details for d2pinb_

PDB Entry: 2pin, 2.3 Å

PDB Description: thyroid receptor beta in complex with inhibitor

PDB Compounds: (B:) Thyroid hormone receptor Beta-1

SCOPe Domain Sequences for d2pinb_:

Sequence; same for both SEQRES and ATOM records:

>d2pinb_ a.123.1.1 (B:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]}
kpeptdeeweliktvteahvatnaqgshwkqkrkflpedigqapivnapeggkvdleafs
hftkiitpaitrvvdfakklpmfcelpcedqiillkgccmeimslraavrydpesetltl
ngemavtrgqlkngglgvvsdaifrlgmslssfnlddtevallqavllmssdrpglacve
riekyqdsfllafehyinyrkhhvthfwpkllmkvtdlrmigachasrflhmkvecptel
fpplflevfe

Timeline for d2pinb_:

• d2pinb_ first appeared in SCOPe 2.02
  
• d2pinb_ appears in SCOPe 2.07