| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
| Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
| Protein automated matches [190118] (17 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [187278] (3 PDB entries) |
| Domain d3b1lx_: 3b1l X: [195016] automated match to d2zeqa_ mutant |
PDB Entry: 3b1l (more details), 1.85 Å
SCOPe Domain Sequences for d3b1lx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b1lx_ d.15.1.1 (X:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mivfvrfnssygfpvevdsdtsilqlkevvakqqgvpadqlrvifagkelpnhltvqncd
leqqsivhivqrprrr
Timeline for d3b1lx_: