Lineage for d3b1lx_ (3b1l X:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1194675Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1194676Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1195091Protein automated matches [190118] (8 species)
    not a true protein
  7. 1195167Species Mouse (Mus musculus) [TaxId:10090] [187278] (2 PDB entries)
  8. 1195170Domain d3b1lx_: 3b1l X: [195016]
    automated match to d2zeqa_
    mutant

Details for d3b1lx_

PDB Entry: 3b1l (more details), 1.85 Å

PDB Description: crystal structure of parkin ubiquitin-like domain r33q mutant
PDB Compounds: (X:) E3 ubiquitin-protein ligase parkin

SCOPe Domain Sequences for d3b1lx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b1lx_ d.15.1.1 (X:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mivfvrfnssygfpvevdsdtsilqlkevvakqqgvpadqlrvifagkelpnhltvqncd
leqqsivhivqrprrr

SCOPe Domain Coordinates for d3b1lx_:

Click to download the PDB-style file with coordinates for d3b1lx_.
(The format of our PDB-style files is described here.)

Timeline for d3b1lx_: