Lineage for d3sj0x_ (3sj0 X:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734165Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2734166Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2734167Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)
  6. 2734256Protein automated matches [190934] (3 species)
    not a true protein
  7. 2734262Species Geobacter sulfurreducens [TaxId:35554] [189147] (10 PDB entries)
  8. 2734268Domain d3sj0x_: 3sj0 X: [195008]
    automated match to d1os6a_
    complexed with dxc, hec, so4; mutant

Details for d3sj0x_

PDB Entry: 3sj0 (more details), 2 Å

PDB Description: ppca mutant m58s
PDB Compounds: (X:) cytochrome c7

SCOPe Domain Sequences for d3sj0x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sj0x_ a.138.1.1 (X:) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
addivlkakngdvkfphkahqkavpdckkchekgpgkiegfgkemahgkgckgcheeskk
gptkcgechkk

SCOPe Domain Coordinates for d3sj0x_:

Click to download the PDB-style file with coordinates for d3sj0x_.
(The format of our PDB-style files is described here.)

Timeline for d3sj0x_: