![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.124: Phospholipase C/P1 nuclease [48536] (1 superfamily) multihelical |
![]() | Superfamily a.124.1: Phospholipase C/P1 nuclease [48537] (3 families) ![]() duplication: all chain but the N-terminal helix forms two structural repeats |
![]() | Family a.124.1.0: automated matches [194368] (1 protein) not a true family |
![]() | Protein automated matches [194369] (3 species) not a true protein |
![]() | Species Solanum lycopersicum [TaxId:4081] [194382] (3 PDB entries) |
![]() | Domain d3snga_: 3sng A: [195005] automated match to d1ak0a_ complexed with btb, cl, so4, zn |
PDB Entry: 3sng (more details), 2.16 Å
SCOPe Domain Sequences for d3snga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3snga_ a.124.1.0 (A:) automated matches {Solanum lycopersicum [TaxId: 4081]} wskeghvmtcriaqgllndeaahavkmllpeyvngdlsalcvwpdqvrhwykykwtsplh fidtpdkacnfdyerdchdqhgvkdmcvagaiqnfttqlshyregtsdrrynmteallfl shfmgdihqpmhvgftsdaggnsidlrwfrhksnlhhvwdreiiltaakdyyakdinlle ediegnftdgiwsddlaswrecgnvfscvnkfatesiniackwgykgveagetlsddyfn srlpivmkrvaqggirlamllnnvfga
Timeline for d3snga_: