Lineage for d3snga_ (3sng A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2730190Fold a.124: Phospholipase C/P1 nuclease [48536] (1 superfamily)
    multihelical
  4. 2730191Superfamily a.124.1: Phospholipase C/P1 nuclease [48537] (3 families) (S)
    duplication: all chain but the N-terminal helix forms two structural repeats
  5. 2730226Family a.124.1.0: automated matches [194368] (1 protein)
    not a true family
  6. 2730227Protein automated matches [194369] (3 species)
    not a true protein
  7. 2730239Species Solanum lycopersicum [TaxId:4081] [194382] (3 PDB entries)
  8. 2730240Domain d3snga_: 3sng A: [195005]
    automated match to d1ak0a_
    complexed with btb, cl, so4, zn

Details for d3snga_

PDB Entry: 3sng (more details), 2.16 Å

PDB Description: x-ray structure of fully glycosylated bifunctional nuclease tbn1 from solanum lycopersicum (tomato)
PDB Compounds: (A:) Nuclease

SCOPe Domain Sequences for d3snga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3snga_ a.124.1.0 (A:) automated matches {Solanum lycopersicum [TaxId: 4081]}
wskeghvmtcriaqgllndeaahavkmllpeyvngdlsalcvwpdqvrhwykykwtsplh
fidtpdkacnfdyerdchdqhgvkdmcvagaiqnfttqlshyregtsdrrynmteallfl
shfmgdihqpmhvgftsdaggnsidlrwfrhksnlhhvwdreiiltaakdyyakdinlle
ediegnftdgiwsddlaswrecgnvfscvnkfatesiniackwgykgveagetlsddyfn
srlpivmkrvaqggirlamllnnvfga

SCOPe Domain Coordinates for d3snga_:

Click to download the PDB-style file with coordinates for d3snga_.
(The format of our PDB-style files is described here.)

Timeline for d3snga_: