Lineage for d3sp7a_ (3sp7 A:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1454901Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 1454943Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 1454944Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 1454950Protein Apoptosis regulator Bcl-xL [56856] (3 species)
  7. 1454951Species Human (Homo sapiens) [TaxId:9606] [56857] (25 PDB entries)
  8. 1454952Domain d3sp7a_: 3sp7 A: [195002]
    automated match to d2o1ya1
    complexed with 03b, act, zn

Details for d3sp7a_

PDB Entry: 3sp7 (more details), 1.4 Å

PDB Description: crystal structure of bcl-xl bound to bm903
PDB Compounds: (A:) Bcl-2-like protein 1

SCOPe Domain Sequences for d3sp7a_:

Sequence, based on SEQRES records: (download)

>d3sp7a_ f.1.4.1 (A:) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
sefmsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagdef
elryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdk
emqvlvsriaawmatylndhlepwiqenggwdtfvelygnna

Sequence, based on observed residues (ATOM records): (download)

>d3sp7a_ f.1.4.1 (A:) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
sefmsqsnrelvvdflsyklsqkgyswsqfsdeseavkqalreagdefelryrrafsdlt
sqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaaw
matylndhlepwiqenggwdtfvelygnna

SCOPe Domain Coordinates for d3sp7a_:

Click to download the PDB-style file with coordinates for d3sp7a_.
(The format of our PDB-style files is described here.)

Timeline for d3sp7a_: