Lineage for d3tkma_ (3tkm A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1097039Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1097040Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1097041Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1097589Protein Peroxisome proliferator-activated receptor delta, PPAR-DELTA [48526] (1 species)
  7. 1097590Species Human (Homo sapiens) [TaxId:9606] [48527] (14 PDB entries)
  8. 1097591Domain d3tkma_: 3tkm A: [194999]
    automated match to d3gwxa_
    complexed with gol, gw0

Details for d3tkma_

PDB Entry: 3tkm (more details), 1.95 Å

PDB Description: Crystal structure PPAR delta binding GW0742
PDB Compounds: (A:) Peroxisome proliferator-activated receptor delta

SCOPe Domain Sequences for d3tkma_:

Sequence, based on SEQRES records: (download)

>d3tkma_ a.123.1.1 (A:) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
gshmqvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekgl
vwkqlvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygv
heaifamlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnaleldds
dlalfiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadl
rqlvtehaqmmqrikktetetslhpllqeiykdmy

Sequence, based on observed residues (ATOM records): (download)

>d3tkma_ a.123.1.1 (A:) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
gshmqvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekgl
vwglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaif
amlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalf
iaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvt
ehaqmmqrikktetetslhpllqeiykdmy

SCOPe Domain Coordinates for d3tkma_:

Click to download the PDB-style file with coordinates for d3tkma_.
(The format of our PDB-style files is described here.)

Timeline for d3tkma_:

  • d3tkma_ appears in periodic updates to SCOPe 2.02 starting on 2013-05-28
  • d3tkma_ appears in SCOPe 2.03
  • d3tkma_ appears in the current release, SCOPe 2.07, called d3tkma1