Lineage for d3tkma1 (3tkm A:171-441)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009141Protein Peroxisome proliferator-activated receptor delta, PPAR-DELTA [48526] (1 species)
  7. 2009142Species Human (Homo sapiens) [TaxId:9606] [48527] (16 PDB entries)
  8. 2009143Domain d3tkma1: 3tkm A:171-441 [194999]
    Other proteins in same PDB: d3tkma2
    automated match to d3gwxa_
    complexed with gol, gw0

Details for d3tkma1

PDB Entry: 3tkm (more details), 1.95 Å

PDB Description: Crystal structure PPAR delta binding GW0742
PDB Compounds: (A:) Peroxisome proliferator-activated receptor delta

SCOPe Domain Sequences for d3tkma1:

Sequence, based on SEQRES records: (download)

>d3tkma1 a.123.1.1 (A:171-441) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
qvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkq
lvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheai
famlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlal
fiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlv
tehaqmmqrikktetetslhpllqeiykdmy

Sequence, based on observed residues (ATOM records): (download)

>d3tkma1 a.123.1.1 (A:171-441) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
qvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwgl
ppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamla
sivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaai
ilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaq
mmqrikktetetslhpllqeiykdmy

SCOPe Domain Coordinates for d3tkma1:

Click to download the PDB-style file with coordinates for d3tkma1.
(The format of our PDB-style files is described here.)

Timeline for d3tkma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tkma2