Lineage for d3tolb_ (3tol B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1263159Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1263194Superfamily a.24.3: Cytochromes [47175] (2 families) (S)
    Heme-containing proteins
  5. 1263195Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
    automatically mapped to Pfam PF07361
  6. 1263206Protein automated matches [190502] (2 species)
    not a true protein
  7. 1263207Species Escherichia coli [TaxId:562] [187450] (29 PDB entries)
  8. 1263229Domain d3tolb_: 3tol B: [194998]
    automated match to d3de8a_
    complexed with ca, hem, zn

Details for d3tolb_

PDB Entry: 3tol (more details), 2 Å

PDB Description: Crystal structure of an engineered cytochrome cb562 that forms 1D, Zn-mediated coordination polymers
PDB Compounds: (B:) Soluble cytochrome b562

SCOPe Domain Sequences for d3tolb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tolb_ a.24.3.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvekalekmlaaaadalkatppkledkspdspemrd
frhgfailmgqihdaahlanegkvkeaqaaaeqlkttcnachqkyr

SCOPe Domain Coordinates for d3tolb_:

Click to download the PDB-style file with coordinates for d3tolb_.
(The format of our PDB-style files is described here.)

Timeline for d3tolb_: