![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.3: Cytochromes [47175] (3 families) ![]() Heme-containing proteins |
![]() | Family a.24.3.1: Cytochrome b562 [47176] (2 proteins) automatically mapped to Pfam PF07361 |
![]() | Protein Cytochrome b562 [47177] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [47178] (75 PDB entries) |
![]() | Domain d3tolb_: 3tol B: [194998] automated match to d3de8a_ complexed with ca, hem, zn |
PDB Entry: 3tol (more details), 2 Å
SCOPe Domain Sequences for d3tolb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tolb_ a.24.3.1 (B:) Cytochrome b562 {Escherichia coli [TaxId: 562]} adlednmetlndnlkviekadnaaqvekalekmlaaaadalkatppkledkspdspemrd frhgfailmgqihdaahlanegkvkeaqaaaeqlkttcnachqkyr
Timeline for d3tolb_: