SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3vija_ (3vij A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (86 species)
    not a true protein
  7. 2083985Species Neotermes koshunensis [TaxId:60586] [189411] (13 PDB entries)
  8. 2083989Domain d3vija_: 3vij A: [194993]
    automated match to d3ahza_
    complexed with bgc, cl, gol, na

Details for d3vija_

PDB Entry: 3vij (more details), 1.03 Å

PDB Description: Crystal structure of beta-glucosidase from termite Neotermes koshunensis in complex with glucose
PDB Compounds: (A:) Beta-glucosidase

SCOPe Domain Sequences for d3vija_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vija_ c.1.8.0 (A:) automated matches {Neotermes koshunensis [TaxId: 60586]}
tvytfpdefklgaatasyqiegawdengkgpniwdtlthehpdyvvdgatgdiaddsyhl
ykedvkilkelgaqvyrfsiswarvlpeghdnivnqdgidyynnlinellangiepmvtm
yhwdlpqalqdlggwpnlvlakysenyarvlfknfgdrvklwltfnapltfmdgyaseig
mapsintpgigdylaahtvihahariyhlydqefraeqggkvgislninwcepatnsaed
rascenyqqfnlglyahpifteegdypavlkdrvsrnsadegytdsrlpqftaeeveyir
gthdflginfytallgksgvegyepsryrdsgviltqdaawpisasswlkvvpwgfrkel
nwikneynnppvfitengfsdygglndtgrvhyytehlkemlkaihedgvnvigytawsl
mdnfewlrgysekfgiyavdfedparpripkesakvlaeimntrkiperfrd

SCOPe Domain Coordinates for d3vija_:

Click to download the PDB-style file with coordinates for d3vija_.
(The format of our PDB-style files is described here.)

Timeline for d3vija_: