Lineage for d4csmb_ (4csm B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 51199Fold a.130: Chorismate mutase II [48599] (1 superfamily)
  4. 51200Superfamily a.130.1: Chorismate mutase II [48600] (2 families) (S)
  5. 51206Family a.130.1.2: Allosteric chorismate mutase [48604] (1 protein)
  6. 51207Protein Allosteric chorismate mutase [48605] (1 species)
  7. 51208Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48606] (5 PDB entries)
  8. 51214Domain d4csmb_: 4csm B: [19499]

Details for d4csmb_

PDB Entry: 4csm (more details), 2.8 Å

PDB Description: yeast chorismate mutase + tyr + endooxabicyclic inhibitor

SCOP Domain Sequences for d4csmb_:

Sequence, based on SEQRES records: (download)

>d4csmb_ a.130.1.2 (B:) Allosteric chorismate mutase {Baker's yeast (Saccharomyces cerevisiae)}
mdftkpetvlnlqnirdelvrmedsiifkfiershfatcpsvyeanhpgleipnfkgsfl
dwalsnleiahsrirrfespdetpffpdkiqksflpsinypqilapyapevnyndkikkv
yiekiipliskrdgddknnfgsvatrdieclqslsrrihfgkfvaeakfqsdiplytkli
kskdvegimknitnsaveekilerltkkaevygvdptnesgerritpeylvkiykeivip
itkeveveyllrrlee

Sequence, based on observed residues (ATOM records): (download)

>d4csmb_ a.130.1.2 (B:) Allosteric chorismate mutase {Baker's yeast (Saccharomyces cerevisiae)}
mdftkpetvlnlqnirdelvrmedsiifkfiershfatcpsvyeanhpgleipnfkgsfl
dwalsnleiahsrirrfespdetpffpdkiqksflpsinypqilapyapevnyndkikkv
yiekiipliskrdgddknnfgsvatrdieclqslsrrihfgkfvaeakfqsdiplytkli
kskdvegimknitnsaveekilerltkkaevygvdpterritpeylvkiykeivipitke
veveyllrrlee

SCOP Domain Coordinates for d4csmb_:

Click to download the PDB-style file with coordinates for d4csmb_.
(The format of our PDB-style files is described here.)

Timeline for d4csmb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4csma_