Lineage for d4csmb_ (4csm B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011335Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 2011336Superfamily a.130.1: Chorismate mutase II [48600] (5 families) (S)
  5. 2011369Family a.130.1.2: Allosteric chorismate mutase [48604] (1 protein)
    duplication: 2 weak structural repeats resembling subunits of E. coli protein
  6. 2011370Protein Allosteric chorismate mutase [48605] (1 species)
  7. 2011371Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48606] (5 PDB entries)
  8. 2011376Domain d4csmb_: 4csm B: [19499]
    complexed with tsa, tyr

Details for d4csmb_

PDB Entry: 4csm (more details), 2.8 Å

PDB Description: yeast chorismate mutase + tyr + endooxabicyclic inhibitor
PDB Compounds: (B:) chorismate mutase

SCOPe Domain Sequences for d4csmb_:

Sequence, based on SEQRES records: (download)

>d4csmb_ a.130.1.2 (B:) Allosteric chorismate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdftkpetvlnlqnirdelvrmedsiifkfiershfatcpsvyeanhpgleipnfkgsfl
dwalsnleiahsrirrfespdetpffpdkiqksflpsinypqilapyapevnyndkikkv
yiekiipliskrdgddknnfgsvatrdieclqslsrrihfgkfvaeakfqsdiplytkli
kskdvegimknitnsaveekilerltkkaevygvdptnesgerritpeylvkiykeivip
itkeveveyllrrlee

Sequence, based on observed residues (ATOM records): (download)

>d4csmb_ a.130.1.2 (B:) Allosteric chorismate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdftkpetvlnlqnirdelvrmedsiifkfiershfatcpsvyeanhpgleipnfkgsfl
dwalsnleiahsrirrfespdetpffpdkiqksflpsinypqilapyapevnyndkikkv
yiekiipliskrdgddknnfgsvatrdieclqslsrrihfgkfvaeakfqsdiplytkli
kskdvegimknitnsaveekilerltkkaevygvdpterritpeylvkiykeivipitke
veveyllrrlee

SCOPe Domain Coordinates for d4csmb_:

Click to download the PDB-style file with coordinates for d4csmb_.
(The format of our PDB-style files is described here.)

Timeline for d4csmb_: