SCOPe 2.04: Domain d2q6ma_: 2q6m A:

Lineage for d2q6ma_ (2q6m A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (6 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [189511] (11 PDB entries)

8. Domain d2q6ma_: 2q6m A: [194982]
   automated match to d3ki3a_
   complexed with p34

Details for d2q6ma_

PDB Entry: 2q6m, 1.25 Å

PDB Description: catalytic fragment of cholix toxin from vibrio cholerae in complex with the pj34 inhibitor

PDB Compounds: (A:) Cholix toxin

SCOPe Domain Sequences for d2q6ma_:

Sequence, based on SEQRES records:

>d2q6ma_ d.166.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
gshmavitpqgvtnwtyqeleathqaltregyvfvgyhgtnhvaaqtivnriapvprgnn
teneekwgglyvathaevahgyarikegtgeyglptraerdargvmlrvyipraslerfy
rtntplenaeehitqvighslplrneaftgpesaggedetvigwdmaihavaipstipgn
ayeelaideeavakeqsistkppyke

Sequence, based on observed residues (ATOM records):

>d2q6ma_ d.166.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
gshmavitpqgvtnwtyqeleathqaltregyvfvgyhgtnhvaaqtivnriapvtenee
kwgglyvathaevahgyarikegtgeyglptraerdargvmlrvyipraslerfyrtntp
lenaeehitqvighslplrneaftgpesaggedetvigwdmaihavaipstipgnayeel
aideeavakeqsistkppyke

Timeline for d2q6ma_:

• d2q6ma_ first appeared in SCOPe 2.02
  
• d2q6ma_ appears in SCOPe 2.03
  
• d2q6ma_ appears in SCOPe 2.05
  
• d2q6ma_ appears in the current release, SCOPe 2.08, called d2q6ma1