Lineage for d3sssf_ (3sss F:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1911709Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 1911710Family d.58.56.1: CcmK-like [143415] (4 proteins)
    Pfam PF00936; BMC domain
  6. 1911744Protein automated matches [191074] (6 species)
    not a true protein
  7. 1911774Species Thermosynechococcus elongatus [TaxId:197221] [194973] (3 PDB entries)
  8. 1911782Domain d3sssf_: 3sss F: [194980]
    automated match to d2a1ba1
    complexed with cl

Details for d3sssf_

PDB Entry: 3sss (more details), 2.05 Å

PDB Description: ccmk1 with residues 103-113 deleted
PDB Compounds: (F:) Carbon dioxide concentrating mechanism protein

SCOPe Domain Sequences for d3sssf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sssf_ d.58.56.1 (F:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
aiavgmietlgfpavveaadamvkaarvtlvgyekigsgrvtvivrgdvsevqasvaagv
envkrvnggqvlsthiiarphenleyvlpiryteaveqfrele

SCOPe Domain Coordinates for d3sssf_:

Click to download the PDB-style file with coordinates for d3sssf_.
(The format of our PDB-style files is described here.)

Timeline for d3sssf_: