Lineage for d3sssb1 (3sss B:3-102)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955934Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 2955935Family d.58.56.1: CcmK-like [143415] (4 proteins)
    Pfam PF00936; BMC domain
  6. 2955969Protein automated matches [191074] (7 species)
    not a true protein
  7. 2956008Species Thermosynechococcus elongatus [TaxId:197221] [194973] (3 PDB entries)
  8. 2956012Domain d3sssb1: 3sss B:3-102 [194977]
    Other proteins in same PDB: d3sssa2, d3sssb2, d3sssc2, d3sssd2, d3ssse2, d3sssf2
    automated match to d2a1ba1
    complexed with cl

Details for d3sssb1

PDB Entry: 3sss (more details), 2.05 Å

PDB Description: ccmk1 with residues 103-113 deleted
PDB Compounds: (B:) Carbon dioxide concentrating mechanism protein

SCOPe Domain Sequences for d3sssb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sssb1 d.58.56.1 (B:3-102) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
iavgmietlgfpavveaadamvkaarvtlvgyekigsgrvtvivrgdvsevqasvaagve
nvkrvnggqvlsthiiarphenleyvlpiryteaveqfre

SCOPe Domain Coordinates for d3sssb1:

Click to download the PDB-style file with coordinates for d3sssb1.
(The format of our PDB-style files is described here.)

Timeline for d3sssb1: