![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [194968] (9 PDB entries) |
![]() | Domain d3tikc1: 3tik C:32-477 [194970] Other proteins in same PDB: d3tika2, d3tikb2, d3tikc2, d3tikd2 automated match to d3l4db_ complexed with hem, jkf |
PDB Entry: 3tik (more details), 2.05 Å
SCOPe Domain Sequences for d3tikc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tikc1 a.104.1.0 (C:32-477) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} ppvypvtvpilghiiqfgksplgfmqeckrqlksgiftinivgkrvtivgdphehsrffl prnevlsprevysfmvpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqhevr kfmaanwdkdegeinlledcstmiintacqclfgedlrkrldarrfaqllakmesslipa avflpillklplpqsarcheartelqkilseiiiarkeeevnkdsstsdllsgllsavyr dgtpmslhevcgmivaamfagqhtssitttwsmlhlmhpanvkhlealrkeieefpaqln ynnvmdempfaercaresirrdppllmlmrkvmadvkvgsyvvpkgdiiacspllshhde eafpeprrwdperdekvegafigfgagvhkcigqkfgllqvktilatafrsydfqllrde vpdpdyhtmvvgptasqcrvkyirrk
Timeline for d3tikc1: