Lineage for d2csma_ (2csm A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 51199Fold a.130: Chorismate mutase II [48599] (1 superfamily)
  4. 51200Superfamily a.130.1: Chorismate mutase II [48600] (2 families) (S)
  5. 51206Family a.130.1.2: Allosteric chorismate mutase [48604] (1 protein)
  6. 51207Protein Allosteric chorismate mutase [48605] (1 species)
  7. 51208Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48606] (5 PDB entries)
  8. 51212Domain d2csma_: 2csm A: [19497]

Details for d2csma_

PDB Entry: 2csm (more details), 2.8 Å

PDB Description: tyr-bound t-state of yeast chorismate mutase

SCOP Domain Sequences for d2csma_:

Sequence, based on SEQRES records: (download)

>d2csma_ a.130.1.2 (A:) Allosteric chorismate mutase {Baker's yeast (Saccharomyces cerevisiae)}
mdftkpetvlnlqnirdelvrmedsiifkfiershfatcpsvyeanhpgleipnfkgsfl
dwalsnleiahsrirrfespdetpffpdkiqksflpsinypqilapyapevnyndkikkv
yiekiipliskrdgddknnfgsvatrdieclqslsrrihfgkfvaeakfqsdiplytkli
kskdvegimknitnsaveekilerltkkaevygvdptnesgerritpeylvkiykeivip
itkeveveyllrrl

Sequence, based on observed residues (ATOM records): (download)

>d2csma_ a.130.1.2 (A:) Allosteric chorismate mutase {Baker's yeast (Saccharomyces cerevisiae)}
mdftkpetvlnlqnirdelvrmedsiifkfiershfatcpsvyeanhpgleipnfkgsfl
dwalsnleiahsrirrfespdetpffpdkiqksflpsinypqilapyapevnyndkikkv
yiekiipliskrdgddknnfgsvatrdieclqslsrrihfgkfvaeakfqsdiplytkli
kskdvegimknitnsaveekilerltkkaevygvritpeylvkiykeivipitkevevey
llrrl

SCOP Domain Coordinates for d2csma_:

Click to download the PDB-style file with coordinates for d2csma_.
(The format of our PDB-style files is described here.)

Timeline for d2csma_: