Lineage for d3tikb_ (3tik B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1277465Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1277466Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1278000Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1278001Protein automated matches [190847] (33 species)
    not a true protein
  7. 1278293Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [194968] (6 PDB entries)
  8. 1278311Domain d3tikb_: 3tik B: [194969]
    automated match to d3l4db_
    complexed with hem, jkf

Details for d3tikb_

PDB Entry: 3tik (more details), 2.05 Å

PDB Description: Sterol 14-alpha demethylase (CYP51) from Trypanosoma brucei in complex with the tipifarnib derivative 6-((4-chlorophenyl)(methoxy)(1-methyl-1H-imidazol-5-yl)methyl)-4-(2,6-difluorophenyl)-1-methylquinolin-2(1H)-one
PDB Compounds: (B:) sterol 14-alpha demethylase (CYP51)

SCOPe Domain Sequences for d3tikb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tikb_ a.104.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
kgklppvypvtvpilghiiqfgksplgfmqeckrqlksgiftinivgkrvtivgdphehs
rfflprnevlsprevysfmvpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiq
hevrkfmaanwdkdegeinlledcstmiintacqclfgedlrkrldarrfaqllakmess
lipaavflpillklplpqsarcheartelqkilseiiiarkeeevnkdsstsdllsglls
avyrdgtpmslhevcgmivaamfagqhtssitttwsmlhlmhpanvkhlealrkeieefp
aqlnynnvmdempfaercaresirrdppllmlmrkvmadvkvgsyvvpkgdiiacsplls
hhdeeafpeprrwdperdekvegafigfgagvhkcigqkfgllqvktilatafrsydfql
lrdevpdpdyhtmvvgptasqcrvkyirrk

SCOPe Domain Coordinates for d3tikb_:

Click to download the PDB-style file with coordinates for d3tikb_.
(The format of our PDB-style files is described here.)

Timeline for d3tikb_: