Lineage for d3tikb1 (3tik B:32-477)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2006000Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [194968] (7 PDB entries)
  8. 2006010Domain d3tikb1: 3tik B:32-477 [194969]
    Other proteins in same PDB: d3tika2, d3tikb2, d3tikc2, d3tikd2
    automated match to d3l4db_
    complexed with hem, jkf

Details for d3tikb1

PDB Entry: 3tik (more details), 2.05 Å

PDB Description: Sterol 14-alpha demethylase (CYP51) from Trypanosoma brucei in complex with the tipifarnib derivative 6-((4-chlorophenyl)(methoxy)(1-methyl-1H-imidazol-5-yl)methyl)-4-(2,6-difluorophenyl)-1-methylquinolin-2(1H)-one
PDB Compounds: (B:) sterol 14-alpha demethylase (CYP51)

SCOPe Domain Sequences for d3tikb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tikb1 a.104.1.0 (B:32-477) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
ppvypvtvpilghiiqfgksplgfmqeckrqlksgiftinivgkrvtivgdphehsrffl
prnevlsprevysfmvpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqhevr
kfmaanwdkdegeinlledcstmiintacqclfgedlrkrldarrfaqllakmesslipa
avflpillklplpqsarcheartelqkilseiiiarkeeevnkdsstsdllsgllsavyr
dgtpmslhevcgmivaamfagqhtssitttwsmlhlmhpanvkhlealrkeieefpaqln
ynnvmdempfaercaresirrdppllmlmrkvmadvkvgsyvvpkgdiiacspllshhde
eafpeprrwdperdekvegafigfgagvhkcigqkfgllqvktilatafrsydfqllrde
vpdpdyhtmvvgptasqcrvkyirrk

SCOPe Domain Coordinates for d3tikb1:

Click to download the PDB-style file with coordinates for d3tikb1.
(The format of our PDB-style files is described here.)

Timeline for d3tikb1: