Lineage for d3tywa1 (3tyw A:17-411)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005897Species Streptomyces coelicolor [TaxId:1902] [194965] (1 PDB entry)
  8. 2005898Domain d3tywa1: 3tyw A:17-411 [194967]
    Other proteins in same PDB: d3tywa2, d3tywb2, d3tywc2, d3tywd2
    automated match to d2zbxa_
    complexed with hem

Details for d3tywa1

PDB Entry: 3tyw (more details), 2.9 Å

PDB Description: crystal structure of cyp105n1 from streptomyces coelicolor a3(2)
PDB Compounds: (A:) putative cytochrome P450

SCOPe Domain Sequences for d3tywa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tywa1 a.104.1.0 (A:17-411) automated matches {Streptomyces coelicolor [TaxId: 1902]}
pprdfpiqrgcpfaapaeyaalrtddpvarvtlptrreawvvtryddvrellsdprvsad
irrpgfpalgegeqeagarfrpfirtdapehtryrrmllpaftvrrvramrpavqarvde
ildgmlaaggpvdlvsayanavstsvicellgiprhdleffrdvtrisgsrnstaeqvse
algglfgllgglvaerreeprddlisklvtdhlvpgnvtteqllstlgitinagrettts
mialstlllldrpelpaelrkdpdlmpaavdellrvlsvadsiplrvaaedielsgrtvp
addgviallaganhdpeqfddpervdfhrtdnhhvafgygvhqcvgqhlarlelevalet
llrrvptlrlagerdqvvvkhdsatfgleelmvtw

SCOPe Domain Coordinates for d3tywa1:

Click to download the PDB-style file with coordinates for d3tywa1.
(The format of our PDB-style files is described here.)

Timeline for d3tywa1: