Class a: All alpha proteins [46456] (285 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (40 species) not a true protein |
Species Streptomyces coelicolor [TaxId:1902] [194965] (1 PDB entry) |
Domain d3tywb_: 3tyw B: [194966] automated match to d2zbxa_ complexed with hem |
PDB Entry: 3tyw (more details), 2.9 Å
SCOPe Domain Sequences for d3tywb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tywb_ a.104.1.0 (B:) automated matches {Streptomyces coelicolor [TaxId: 1902]} pprdfpiqrgcpfaapaeyaalrtddpvarvtlptrreawvvtryddvrellsdprvsad irrpgfpalgegeqeagarfrpfirtdapehtryrrmllpaftvrrvramrpavqarvde ildgmlaaggpvdlvsayanavstsvicellgiprhdleffrdvtrisgsrnstaeqvse algglfgllgglvaerreeprddlisklvtdhlvpgnvtteqllstlgitinagrettts mialstlllldrpelpaelrkdpdlmpaavdellrvlsvadsiplrvaaedielsgrtvp addgviallaganhdpeqfddpervdfhrtdnhhvafgygvhqcvgqhlarlelevalet llrrvptlrlagerdqvvvkhdsatfgleelmvtwhh
Timeline for d3tywb_: