SCOPe 2.02: Domain d2ocia_: 2oci A:

Lineage for d2ocia_ (2oci A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188340] (5 PDB entries)

8. Domain d2ocia_: 2oci A: [194960]
   automated match to d2ocla_
   complexed with mg, mn, tyc

Details for d2ocia_

PDB Entry: 2oci, 1.9 Å

PDB Description: Crystal structure of valacyclovir hydrolase complexed with a product analogue

PDB Compounds: (A:) Valacyclovir hydrolase

SCOPe Domain Sequences for d2ocia_:

Sequence; same for both SEQRES and ATOM records:

>d2ocia_ c.69.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svtsakvavngvqlhyqqtgegdhavlllpgmlgsgetdfgpqlknlnkklftvvawdpr
gyghsrppdrdfpadfferdakdavdlmkalkfkkvsllgwsdggitaliaaakypsyih
kmviwganayvtdedsmiyegirdvskwsertrkplealygydyfartcekwvdgirqfk
hlpdgnicrhllprvqcpalivhgekdplvprfhadfihkhvkgsrlhlmpegkhnlhlr
fadefnklaedflq

Timeline for d2ocia_:

• d2ocia_ is new in SCOPe 2.02-stable
  
• d2ocia_ appears in SCOPe 2.03
  
• d2ocia_ appears in the current release, SCOPe 2.08